GenomeNet

>ret:RHE_CH01196 probable glutathione S-transferase protein (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MTAAACSLSPHIVCRELGLDIELVEVDRETQRTSDGKDYLAINGNGYVPALMLDDGKVLT
EGPAIAQFLADSVPQGAAMLPEVGNLRRNEVQSYLNFISAELHKPMVLLFNPAYASVHEQ
IRAQVAKRLSWLSGRFAGPYLTGEAFTVADAYLFVCLNWSPWTQINLKQWPALHGFMARV
AARPKVREALRAEDLRAFDVDGVYFAPNAYLASSNWTGSPVQP

BLAST