GenomeNet

>ret:RHE_CH01196 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) probable glutathione S-transferase protein (A)
MTAAACSLSPHIVCRELGLDIELVEVDRETQRTSDGKDYLAINGNGYVPALMLDDGKVLT
EGPAIAQFLADSVPQGAAMLPEVGNLRRNEVQSYLNFISAELHKPMVLLFNPAYASVHEQ
IRAQVAKRLSWLSGRFAGPYLTGEAFTVADAYLFVCLNWSPWTQINLKQWPALHGFMARV
AARPKVREALRAEDLRAFDVDGVYFAPNAYLASSNWTGSPVQP

BLAST