GenomeNet

>ret:RHE_CH01400 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (GenBank) sodC; superoxide dismutase protein (A)
MKAIHITAALSLLALALPASAQNKQTAVANFVGKDGKENGRAQMTAAANGGVLIEVEISE
LPANKWVAFHVHETGRCDAATHYESAGGHFNPDSAEHGILAAKGPHAGDMPNQYVGQDGV
LRAQIFDGMVTLDGKKDGIRGRTLMVHANSDDYRSQPSGDAGERLACGVVQ

BLAST