GenomeNet

>ret:RHE_CH03084 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase protein (A)
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPDEDLFRLVMTLSGEGAPISCVFVDEAHFMTPLHVWQLARIVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAQGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGAWIAEPV

BLAST