GenomeNet

>ret:RHE_CH03648 K01805 xylose isomerase [EC:5.3.1.5] | (GenBank) xylA; xylose isomerase protein (A)
MSTGFFGDIQKIKYEGPDSTNPLAFRYYQPDEIVLGKRMEDHLRFAVAYWHTFTWPGGDP
FGGQTFLRPWFEDTMKAAKLKADVAFEFFSLLGAPYYCFHDADVRPEGKNFAENTKNLNE
IVDYFAEKQAATGTKLLWGTANLFSNRRYMSGAATNPDPDVFAFAAATVKTCIDATQKLG
GENYVLWGGREGYETLLNTDLKRELDQLGRFLNLVVEYKHKIGFKGTILIEPKPQEPTKH
QYDYDVATVYGFLKKHGLENEVKVNIEQGHAILAGHSFEHELALANALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFKTGGTNFDSKLRRQSLDPADLLIGHIGGMD
CCARGLKAAAKMIEDKALSQPLADRYAGWESVEAQKLFRGEYSLDEIANWVESKDVNPQP
KSGKQELLENVVNRYV

BLAST