GenomeNet

>ret:RHE_CH04055 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (GenBank) probable aldehyde dehydrogenase protein (A)
MTIAVLDLATETAKLLAELGVDAGRYHGGTLSVTSPVTGKEIGKLREHTVSETKAAIEEA
HKAFLEWRDVPAPKRGELVRLLGEELRAAKTALGRLVSIEVGKITSEGLGEVQEMIDICD
FAVGLSRQLYGLTIATERSEHRMMESWHPLGAIGIISAFNFPVAVWSWNAALAMVCGNST
VWKPSEKTPLTALAVQALFEKALKRFVAEGGKAPANLSTLIIGGREVGEVLVDHPKIPLV
SATGSTAMGRAVGPRLSQRFARAILELGGNNAAIVCPSADLDLTLRGVAFSAMGTAGQRC
TTLRRLFVHDSVYDQLVPRLQKAYGSVTIGNPLEAGTLVGPLIDGQAFEKMQAALGEAKS
AGGKVTGGERVDNGSADAFYVRPALVEMPAQTGPVEHETFAPILYVMKYSDFDAVLALHN
AVPQGLSSSIFTNDMREAETFVSARGSDCGIANVNLGPSGAEIGGAFGGEKETGGGRESG
SDAWKAYMRRATNTINYGSTLPLAQGVKFDVE

BLAST