GenomeNet

>ret:RHE_PE00251 DNA ligase (ATP) protein (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MTRSRRPSAPLLRDSSSSIQSRPVRRRDPDQPNLPFDAMPSRVEPCLALLKQTVPQGPDW
LYEVKWDGYRLALHIEPKGIRILTRGGHDWTRRFPTIAARARELGVSSCILDGEAVVLDE
EGRSDFGALQRSLGGRGGKRISTESIFYAFDLLYLDGHDLTRTELSVRRHLLEDLIPAAD
GGAIRFSQELDLGGEELLEHACRLGMEGIIAKRTDSPYRSGRLGDWQKIKCVQSESFMIV
GYEESASTRGGLGSLLLAGRKGHDWIYVGSVGTGFNRTEAEYLRKTLNRLQTKKPIVPLK
GKRLVFSQPTLIAEIEFRGWTREGSLRHPSYKGLREIQDNAAVFDMADGPAAIR

BLAST