GenomeNet

>ret:RHE_PE00252 putative ATP-dependent DNA ligase protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MASDKLSSYRSKRDFQKTAEPSGERSLKQSNRRRFVIQKHDATRLHYDLRLELDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGRKSPE
QALSKGDFKFTLEGERLHGSFVLVRMRNDRERSKRTNWLLIKHHDEFSVDENGASILEEN
VTSVASGRSMEMIAAGKGRKPKPFMVEGGKVQADAVWDSNHGLAAEERQSEASAGKRAGT
ATAVDLPDFIAPQLCEKVERPPGGDGWIHEIKFDGYRIQMRVLDGEVTLKTRKGLDWTAK
YPEIAEAASGLPDCILDGEICALDEQGAPNFAALQAALSEGKTASLVYFAFDLLYDGGED
LRSKPLIERKRRLQELLTEAGNDPRIRYVEHFETGGDAVLRSACKLSLEGIISKQTDAPY
QSGRTESWAKSKCRAGHEVVIGAYAKTNGRFRSLLAGVFRGDHFVYVGRVGTGYGAKKVE
TLLPKLKALETARSPFTGIGAPKKQAEVVWVKPELVAEIEFEGWTADGLVRQAAFKGLRE
DKPAREVEAEPPVRPAKADIAEPVPRARQTPARRKGAKADVMGVLISNPDKPLWPDANGS
EPVTKEELAGYYEAVGDWMIDHIKGRPCSIIRAPDGIGGEQFFQRHAMPGQSNLLDLVKV
FGDKKPYLQIDRIEGLAAVAQIAAVELHPWNCEPGQPEVPGRLVFDLDPGPDVPFATVVA
AAREMRDRLEDLGLISFCKTTGGKGLHVVTPLAVNKRKPLSWPEAKAFAHDVCQQMARNN
PDLYLIKMTKSLRGGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLTWTQVKSDLDPK
RFTIRTVPALLSKSSAWKDYCEGQRPLEQAIKKLGRAGKHAA

BLAST