GenomeNet

>rey:O5Y_20260 K16051 3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5] | (GenBank) hypothetical protein (A)
MADPTVRPISAADITTWDYEADVVVAGYGIAGVTAAIEAARAGAEVLVLERTGGWGGAAS
LAGGFIYLGGGTPLQKACGFEDSVENMKTFMKAALGPGTDDTKIDAYCEGSVDHYNWLVD
AGVPFKESFWGQPGWEPPYDDGLMYSGGENAAPFNALVDPAPRGHVPQMSEKKTGEQGGG
YMLMKPLVETAEKLGVRAEYDLRVQTLVVDGDRVVGVVAKRYGKDVAIRARKGVVLAMGS
FAYNNEMVRSNAPRIFGHPAASTEAHDGRAIQIGQALGADTAHMDATEVAFFCDPQLMVR
GILVNGRGQRYIPEDTYPGRIGQATLFQQDNQAFLVIDEAAYEEGMNAESSSAQLRAQPT
WVAETVEELEAEMGLPAGSLQSTVDLYNRHAAEGSDPVLGKKSEWVKPIVGPFAAIDLRG
RTGGFTLGGLKTTVDSEVLHVSGAPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFFGRRA
GISAAR

BLAST