GenomeNet

>rfr:Rfer_1089 glutathione S-transferase-like protein; K04097 glutathione S-transferase [EC:2.5.1.18] (A)
MLKLVIGNKNYSSWSMRPWVLLKQAEIPFEEIKVRFDAFTPDSSFKKTVNALTPTGKVPV
LIDGDLVVWDTLAIAEYVAEQFADKHLWPRDKATRARARSLCAEMHAGFTGLRSHCPMNI
EARLPEVGALIWRDQPTVRSDVARLVAMWDELLKAHGGPMLFGDFSVADAYFAPICTRLT
SYALPLPPAIADYVARVQALPGVKAWIDGALAEQDFLDFEEPYRLKR

BLAST