GenomeNet

>rge:RGE_04890 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S transferase domain containing protein (A)
MALQLVIGNKNYSSWSMRPWVLMRQLGIEFQERKLRFDFAEGSDFRRQVAAVSPAGLVPV
LLDEGFAVWDTLAIAEYLAERFPQAGVWPADAKQRARARSLCAEMHGGFGALRQHCAMNI
EAALPDVGQKLWAEQPALRRNVARLESMWAEALDASGGPFLFGEFGAADAFYAPVCTRIV
SYALPVSDATRAYVRRVLAAPGVAAWIADALAEADYIADEEPYRSAR

BLAST