GenomeNet

>rge:RGE_26430 ligD; ATP-dependent DNA ligase LigD (EC:6.5.1.1); K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MPRTAAPARDPLQHYRERRDFRATPEPGADAVQPGADTGRFVIQKHDATRLHYDFRLELD
GVLLSWAVPKGPSLDPADRRMAVRTEDHPLAYADFEGRIPAGHYGAGQVIVWDRGSWTPL
AEPRAALAAGKLPFELDGEKLHGAWELVRMKPKPGERGENWLLFKKRDAQARPRAEFDVV
AEQPDSVAATAADKPRRRQSRAALALDSVAPKAPQPETLAPQLATLASAAPSSGSWLYET
KFDGYRLLARIRRGVPRLFTRNGHDWTDKLPALAAALKGLGLQSAWIDGELVALGSRGAA
DFNALQNAFDGRDTARLLYYVFDLPYVQGRDLRELALDTRRALLQSLLDEHPLDGVRFSE
ELPAGGAGPLATACERQLEGVIAKRRDAPYRSLRSEAWLKLKCRRRQEFVVAGYTERTNA
SGEIGSLILAVHDADGRLVHAGKVGTGWDTRAARDLFTRLQPLAREAVPFAAGTPSPGRW
SRRAPGLERWVRPEFVVEVEFAEWTPGGSVRHAVFVGVREDKPAAQVLRERAVVPDTAPS
AAPTASSSGRIARVRITHGERIVDKASGLSKLDLLRWYDGVAERMLPHLKARPVALLRAP
QGVGRPVFFQKHAERTEIPGLVLLDPALWPGHEPLMEIRSAEALLSAAQMNTIEFHTWNA
TTRTIAKPDRLVFDLDPGEGVDFAAVREGALLVRTLLDELGLASWLKTSGGKGLHVVVPV
APRVAVDVVKPFSRAVVAHLAEQVPERFVVRSGPANRVGRIFVDWLRNGEGATTVAAFSA
RARPGLGVSIPVSWDALPELRGGDQWTLANAREHLSFEREDPWAAFWTTRQALAPAMRRL
GFDPRAGGDGR

BLAST