GenomeNet

>rge:RGE_29250 glutathione S transferase domain containing protein; K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MIEVYSWATPNGHKVHVMLEECGLPYRVHAVDIGAGEQFAPEFLAISPNNKIPAIVDPDG
PDGQPISLFESGAILLYLAGKTGRFLPASVRGKYETLEWLMFQMGGVGPMLGQAHHFRIY
APEKIAYAVDRYTNEAKRLYGVMNRKLAKTRYIAGDEYTIADIAIFPWLRSWKNQGIDWN
DYPHLKGWFDEIGARPAVQRGCEVLADRRKPITDDKSREMLFGATQYRQR

BLAST