GenomeNet

>rge:RGE_29250 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (GenBank) glutathione S transferase domain containing protein (A)
MIEVYSWATPNGHKVHVMLEECGLPYRVHAVDIGAGEQFAPEFLAISPNNKIPAIVDPDG
PDGQPISLFESGAILLYLAGKTGRFLPASVRGKYETLEWLMFQMGGVGPMLGQAHHFRIY
APEKIAYAVDRYTNEAKRLYGVMNRKLAKTRYIAGDEYTIADIAIFPWLRSWKNQGIDWN
DYPHLKGWFDEIGARPAVQRGCEVLADRRKPITDDKSREMLFGATQYRQR

BLAST