GenomeNet

>rge:RGE_36050 cbbS; ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit CbbS (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MMTNPTGRLTQGQFSFLPDLTDEEITLQIEYGLKKGYAWSIEYTDDPHPRNTYWEMYGMP
MFDLQDAAGVLMELNACRKTFPNHYIRLMAFDSTRGIESIAMSFLVNRPPTEPGFGVVRQ
EVNGRSMRYTVHSYATDKPEAQRY

BLAST