GenomeNet

>rha:RHA1_ro11147 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP-dependent DNA ligase (A)
MRLIAPMLATAGTLPDNTDRPWSFEMKYDGCRMLASVGGGHEPVLWTRAMNVVTPSYPEI
AEALTAAFGGRGRIVLDGEVVVLDQGKPSFGLLQRRLGVAHATKPLQRRIPVTFLPFDVL
ALDGDDLTKASYLERRAELAELDSTIQDVGGLPITVPPHWDNQSSKIMLNAAKSAGMEGV
LAKRSTSLYLPGQRSRSWIKHAIRTRSSVLVIGFVGSSRSVAALILGAYDAEGRLVQVGS
VSSGLTVSMRRQLREDFRPLERPSSPLTDPSAAAETFPGVQWLNPRLVVDVAYRAHTAGG
LRHPSLKGRRFDVDFQSVRVEDL

BLAST