GenomeNet

>rhi:NGR_b22000 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (RefSeq) rbcL1; ribulose bisphosphate carboxylase large subunit (EC:4.1.1.39) (A)
MIRITYRIETPGDVEALAAKIASDQSTGTFVLVPGETEELKARVAARVVAIRHLEPGDRP
SWPEEAGGAKRFNRAEADIDFPLDAVGTDLAALMTIAIAGVYSIKGMTGVRIVDMQLPPE
FGRAHPGPQFGIPGSRRLTGVEKRPIIGTIVKPALGLRPEETAALVGELLSSGVDFIKDD
EKLMSPAYSPLKARIAAIMPKILDHEQKTGKKVMYAFGISHTDPDEMMRNHDLVVEAGGN
AGVVNINSIGMGGVAFLRKRSGIVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLIGVDQF
QINGIRVKYWEPDESFVKSFKAAGTPLFSERDCPLPVVGSGQWGGQAPETYARTGGSTDL
LYLCGGGIVSHPGGAGAGVRAVRQAWEAAVAGIPLADYARDHPELAQSLIKFADGNGT

BLAST