GenomeNet

>rhi:NGR_c06470 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (RefSeq) rbcL2; ribulose bisphosphate carboxylase large subunit (A)
MNRNDCVVMTYMIECDGDPQSFASKIASDQSTGTFVDLPGETPELKARVAARVLDVRELP
PISVPSIPQNASGPSYRRAEADIAFPIEAVGDDLSALMTITIGGVFSIRGFTGIRVLRMQ
LPHAFGASYPGPQFGIAGTRRLTGVFDRPLIGTIIKPALGLRPNETAEMVSELIASGVDF
IKDDEKLCGPPYSPLEERVRAIMPLIKDHEQRTGKKVMYAFNISHVDPDVMMRNHDVVAD
AGGNAAVININSIGQGAFLFLRRRSRLALHAHRNGWDILTRHPGLGMNFSVYQQYWRLLG
VDQFQINGIGSKYWEPDDSFVQSFHDLVAPFTSAGEKPMPVVCSGQWGGQAPETYRRTGR
TLDLLYLCGGGVVSHPDGPGAGVKAVRQAWEAAREGVDLDSYAQNHPELKQALAKFGKRD

BLAST