GenomeNet

>rhi:NGR_c27230 K00891 shikimate kinase [EC:2.7.1.71] | (RefSeq) shikimate kinase (A)
MNDVTEPASSTLAERAKLTLGKRNLIFIGLMGAGKSAIGRLTAQALGVPFVDSDHEIERV
SRMTVSELFAAYGEEEFRALEARVLKRLLRSGPRVVSTGGGAYINERSRRQIKKGGLTVW
LNADLEVLWERVNKRDTRPLLKTENPKQTLENLMRARYPVYAEADLVVLSRDVKKETMVE
EVLAAIADCKKVEMP

BLAST