GenomeNet

>rhi:NGR_c27230 shikimate kinase; K00891 shikimate kinase [EC:2.7.1.71] (A)
MNDVTEPASSTLAERAKLTLGKRNLIFIGLMGAGKSAIGRLTAQALGVPFVDSDHEIERV
SRMTVSELFAAYGEEEFRALEARVLKRLLRSGPRVVSTGGGAYINERSRRQIKKGGLTVW
LNADLEVLWERVNKRDTRPLLKTENPKQTLENLMRARYPVYAEADLVVLSRDVKKETMVE
EVLAAIADCKKVEMP

BLAST