GenomeNet

>rhi:NGR_c27850 ATP-dependent DNA ligase protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MAARSAPLSEYNRRRDFTKTREPKGAVAPASGDRKRFLVQKHDATRLHYDFRLEWEGVLK
SWAVTRGPSLNPEDKRLAIRTEDHPLAYGDFEGTIPEGEYGGGTVMLWDTGWWEPEGDPS
KGLKKGKLSFRLHGSRMKGGWALVRMRPRDGEKRENWLLVKETDEIASEEGESLIKENVT
SVATGRTMDEIAGGKGEKRARVWHSNKSTAANLKAGAIAGNDNPRKRQARKSSGKLPAFK
APQLATLVTKAPAGETWLNEAKFDGYRLICAIGGGAVRCYTRNGLDWTEKFPAIAAALAE
LDCKSALIDGEVVALSDAGSSFSALQKALKTGASTRLYAFDLIELDGKDLGRAPLIDRKE
KLRGLLDSLGTTATVQYSEHVQGNGEHVLAAICKAGQEGIIAKEAKAPYRSGRTRSWLKV
KCTKRQEFVIGGYTPSSKKGRPFASILVGTFEGGKLIYRGGVGTGFGEKVMEELAAAFAK
RSRETPPFDSVPRERMRKAVWLKPDLVAEVDFAEFTADGHVRHGSFEGLREDKEAKAVKL
ETAKPTGAASKAAKGKPSANTGKASSPKGDTDVLGVQISHPDRILFEGQGITKIDLARYY
AVVADRMLTFAADHPVSLVRCPQGGQRHCFFQKHTNDAFPEAIREVPITESSGETENYMY
VHDAKGLVAAVQMGTLEFHIWGATIDKLETPDRLVFDFDPDPSVDFTTVKNAARALRDEL
ADIGLQSFALVTGGKGVHVVVPLVRRASWDDAKSFAKAVAQNIADRDPDHFVATMSKAKR
KGRIFIDWLRNERGATAIAPYSSRAREGGPIATPVGWDELERLSGANTFRIGDILERIEA
DTDPWRDIGKVKQSLTKKMMDSVIK

BLAST