GenomeNet

>rle:RL2477 K07258 serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4] | (GenBank) dacF; putative penicillin-binding protein (A)
MLKPALRLLACLMPFATGAFAADGGAAGFATKVAQAYMIEATTGTVLLAKNEDQGFSPAS
LAKLMTMDLVFEALTKGQITLDTEYPVSEYAWRTGGAPSRAATMFASLKSRVRVEDLIKG
VAIQGANDSCIILAEGMAGSEQQFAVSMTRRARELGMEKAEFGNSTGLPDGKSKVTAREM
VTLAAALQQTYPNLYPYFAQPDFEWNKIFQRNRNPLLGLDIGADGLATGFTEGEGYSIVA
SVERDGRRLFVALAGIASDKERTEEAKRVLEWGLTAFENRQIFGEKEVIGAASVYGGTAR
TVDLVAKAPVSVYIPISNPDRLSARIIYRWPLAAPVKPDTQAGTLRIFAGSRLLREVPLY
TVQAVGEGSLSSRAVDAMLELGESLFFSWLWDKPAPV

BLAST