GenomeNet

>rle:RL2477 dacF; penicillin-binding protein (EC:3.4.16.4); K07258 D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4] (A)
MLKPALRLLACLMPFATGAFAADGGAAGFATKVAQAYMIEATTGTVLLAKNEDQGFSPAS
LAKLMTMDLVFEALTKGQITLDTEYPVSEYAWRTGGAPSRAATMFASLKSRVRVEDLIKG
VAIQGANDSCIILAEGMAGSEQQFAVSMTRRARELGMEKAEFGNSTGLPDGKSKVTAREM
VTLAAALQQTYPNLYPYFAQPDFEWNKIFQRNRNPLLGLDIGADGLATGFTEGEGYSIVA
SVERDGRRLFVALAGIASDKERTEEAKRVLEWGLTAFENRQIFGEKEVIGAASVYGGTAR
TVDLVAKAPVSVYIPISNPDRLSARIIYRWPLAAPVKPDTQAGTLRIFAGSRLLREVPLY
TVQAVGEGSLSSRAVDAMLELGESLFFSWLWDKPAPV

BLAST