GenomeNet

>rli:RLO149_c002730 K11987 prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1] | (GenBank) heme peroxidase-like protein (A)
MSRIPYNVQKFLFSIVEAIPPLAALVNKFAINRVVKRARTRPHPLSTGRDYVSWSGLTDR
RWSARHLPPQTRDNLPDPEVLQELFRRKEGTQRLCPKSTCLFPAFAQYLTDGFIRTESEH
LTPEGQDPKLHLKRNTSNHDIDMCTLYGRTPAQTDALRLQSSDPGHKGRLKSQMIGDEEY
PPFLYRDGVPDPDFAVLDPPLGGADQSPEKQAKLFAVGGDRVNSVPQVAMLNTLFLREHN
RLAGEIEVVHPDWDDDRVFETARNTVIVIFIKIIVEDYINHISPLPFTLRADPSVAWNAP
WNKPNWITTEFSLLYRWHALIPDQIQWGDDLHPVHTTFMNNDLLIRDGLLKGFAGICATQ
AAELGPRNTAEPLLKVELASIEQDRFCQLAGFSDYCNYMSQQRPASFKAISSDPEISDTL
AKHYGGPRDVDFHVGLFCEDRVPNSPLPNLILVFVALDAFSQALTNPLLSQHVFKRGTFS
APGWSAIRQTESLRDVLDRNVAGGAGDTFIAMTRKEWVPE

BLAST