GenomeNet

>rli:RLO149_c002730 heme peroxidase-like protein (A)
MSRIPYNVQKFLFSIVEAIPPLAALVNKFAINRVVKRARTRPHPLSTGRDYVSWSGLTDR
RWSARHLPPQTRDNLPDPEVLQELFRRKEGTQRLCPKSTCLFPAFAQYLTDGFIRTESEH
LTPEGQDPKLHLKRNTSNHDIDMCTLYGRTPAQTDALRLQSSDPGHKGRLKSQMIGDEEY
PPFLYRDGVPDPDFAVLDPPLGGADQSPEKQAKLFAVGGDRVNSVPQVAMLNTLFLREHN
RLAGEIEVVHPDWDDDRVFETARNTVIVIFIKIIVEDYINHISPLPFTLRADPSVAWNAP
WNKPNWITTEFSLLYRWHALIPDQIQWGDDLHPVHTTFMNNDLLIRDGLLKGFAGICATQ
AAELGPRNTAEPLLKVELASIEQDRFCQLAGFSDYCNYMSQQRPASFKAISSDPEISDTL
AKHYGGPRDVDFHVGLFCEDRVPNSPLPNLILVFVALDAFSQALTNPLLSQHVFKRGTFS
APGWSAIRQTESLRDVLDRNVAGGAGDTFIAMTRKEWVPE

BLAST