GenomeNet

>rli:RLO149_c010140 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase-like protein (A)
MSTARYILHYAPDNASLVIRLALEELRLDYTTQLVDRQNSAQHSPAYRALNPNQLIPVLE
TPQGPIFETAAILLWLSDTHGHLGPGADDPQRAELLKWLFFLSNTLHPALRMLFYPGAYI
GRDVDHVSQLTQMTQSNILRLLGLIDQRWADDRPGILLDLYLGPMMRWLALYPTQSDRTW
FDLTAFDAIHAALRNLEQRPSVETAQQAEGLGRDPFTSPRHPNPPEGSAT

BLAST