GenomeNet

>rlt:Rleg2_2822 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERTGRGVIGSRIGLEASAI
PFEPHEDLFRLIAGLSGEGAPIACVFVDEAHFMTPVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAEGKVLHEGAQIDVGGNEKYV
SLCRRHWDEAMNGAWIAEPV

BLAST