GenomeNet

>rme:Rmet_1500 cbbS; ribulose 1,5-bisphosphate carboxylase/oxygenase, RuBisCO (type I) small subunit (CbbS) (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MSDVMDYNSRLSDPASRKFETFSYLPAMDAASIKRQVEYLVKKGWNPAIEHIEPEYLMDS
YWYMWKLPMFGETDVDRVLAEAKACHKANPNNHVRLVGYDNFKQSQGAAMVVYRGKTV

BLAST