GenomeNet

>rme:Rmet_1500 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS; ribulose 1,5-bisphosphate carboxylase/oxygenase, RuBisCO (type I) small subunit (CbbS) (EC:4.1.1.39) (A)
MSDVMDYNSRLSDPASRKFETFSYLPAMDAASIKRQVEYLVKKGWNPAIEHIEPEYLMDS
YWYMWKLPMFGETDVDRVLAEAKACHKANPNNHVRLVGYDNFKQSQGAAMVVYRGKTV

BLAST