GenomeNet

>rme:Rmet_1501 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) cbbL; ribulose 1,5-bisphosphate carboxylase/oxygenase, RuBisCo (type I) large subunit (CbbL) (EC:4.1.1.39) (A)
MAAKTYNAGVKEYRQTYWTPEYTPKDTDLLACFKVTPQPGVAREEVAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGDDTCFYAFVAYPIDLFEEGSIVNVLTSLVGNVFGF
KALRALRLEDVRFPIAYVMTCGGPPHGIQVERDIMNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWKQRFDFVQEATEKAQRETGERKGHYLNVTAPTP
EEMYKRAEYAKEIGAPIIMHDYLTGGFCANTGLANWCRDNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKCLRLSGGDHLHSGTVVGKLEGDRDATLGWIDIMRDDFIKEDRSRGIMFDQD
FGSMPGVMPVASGGIHVWHMPALVTIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNKGVAVEKEGKSILTEAATHSPELKIAMETWKEIKFEFDTVDKLDVAHK

BLAST