GenomeNet

>rno:288346 RGD1561853; similar to SET domain-containing protein; K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
MPCVNIDFRPATSAFLKKSEEKIHPAFQGPASCREAGRRAGPGLVPANHSGQLRKERATA
PISTHSRCLAEQLATVVATFFESSVSQEIPGGDRAGPWLEENGFAGQSNIYAYRSPNKCP
GMRSPLQEENSVAHHEVKCPGKPLAGIYRKGEEKRNAGNVIRSAVKSEEQKSKDTRRGPQ
APFRNQKSEATEPPKTPPPACDSTSVAVAKQALKKPLKGNQAPRKKSQGKTQQNGKLTDF
YPVRRSSTKSKAELRSEERKKIDELIESGKEEGMKIDLIHGKGRGVIATKRFSRGDFVVE
YRGDLIEITDAKKREALYAQDPSTGCYVYYFQYLSKTYCVDATQETNRLGRLINHSKCGN
CQTKLHDIDGVPRLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

BLAST