GenomeNet

>rno:498012 Ace3, RGD1561299; angiotensin I converting enzyme (peptidyl-dipeptidase A) 3 (EC:3.4.15.1); K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MGFPWAFLLVLLYYGQPLPWPKTVGEPSLDEFYSEAQAKMFLQFYEQTARVVLNELMEAT
WNYVTNITKQNQENMLQKEVERSQFMLYFGTRARMFRIDHFQDLDVKRRLSKLRNIDKSA
LPVEDFQEFNRLLTYMKTAYGRAEVCLDEGPCMPLEPDLEEIMATSRDQKELLWAWQGWR
DAIGRQLRPVFEDYVHLSNKAAQYNGYKDMGALWRSKYESDTLEEDLEQLYKELQPLYLN
LHAYVRRSLYRYYGPELIDLRGPIPAHLLGNMWAQSWNNILDLVLPYPNKPPEDITKIMK
NQHWRPEKMFEEANLFFTSMGMLPAPPAFWMKSMMEKPVDGREVECHTSSWNFYRLNDFR
VKKCTEVTIGDLLSIFHQMGHIQYYLQCQNLSIIYQEGASPAFEEAVGSTITLSAFSHKY
LLTRGLLSQQHQDSEEEVNFLLSIALEKIAFIPFGYMIDLFRWKVFDGTIQKNAYNQEWW
SLRLKYQGLCPPVPRSEDDFDPGAKFHIPANMPYIRYFLSLVLQFQLHEVLCRASGHVGP
LHRCDIYNSKVAGKILGDFLKVGSSRPWQEVLKEITGKPNISTKALLTYFKPLLNWLVTE
NVKQGDILGWPDFSCSFEEKITKKMSFLGMKIEPDQAYLGQWVLLSMSFIMLCLILALGL
RLHYLERRSLDSDTVILSTPPYAYFLGIAMEPRQAARKQWLLLGLCFVLMLCCIGLLIKI
FIHHTRKPPWMKAEWQS

BLAST