GenomeNet

>rno:60327 K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] | (RefSeq) F13a1, F13a; coagulation factor XIII A1 chain (EC:2.3.2.13) (A)
MSDTPATTFGGRRAIPPNNSNAAEVDLPTEDLQGLVPRGVSLKDYLNVTAVHLFKERWDS
NKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPV
PVVTELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTQRDPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFHGDFNDIKSRSWSYGQFEDGILDACL
YVMDKAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYAYGIPPSAWTGSVDIL
LEYRSSETPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGS
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVENVDATHIGKLIVTKEIGGDGMQDITD
TYKFQEGQEEERLALETALMYGAKKTLNTEGVVKSRSDVDMNFDVENAVLGKDFRVTITF
QNNSSNLYTILAYLSGNITFYTGVSKKEFKTESFEVTLDPLSLEKKEVLIRAGEYMSYLL
EQGLLHFFVTARINETRVVLAKQKSIVLTIPKVTIKVRGTAMVGSDMVVTVEFTNPLKET
LKNVWLHLEGPGVMRPKRKMFREIRPNATVQWEEVCQPWVSGHRKLIASMTSDSLRHVYG
ELDLQIRRRPTV

BLAST