GenomeNet

>rno:680537 K11424 histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43] | (RefSeq) Nsd2, RGD1565590, Whsc1; nuclear receptor binding SET domain protein 2 (A)
MKQAPEILGSANGKTQNCEVNHECSVFLSKAQLSNSLQEGVMQKFNGHDALPFLPAEKLK
DLTSCVFNGEPGAHDTKLCFETQEVKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFE
SSICGDGAADMSQSEENGQKSDNKTRRNRKRSIKYDSLLEQGLVEAALVSKISSPEDKKI
PVKKESCPNSGRDRDLLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHNHTKLKGQKKSAR
QYHVQFFGDAPERAWIFEKSLVAFEGEEQFEKLCQESAKQAPTKAEKIKLLKPISGRLRA
QWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLRLNPQVAKEAGIATEPLGEMVDSSVAN
EEAAVDPGTMREEDIPVKRRRRAKRSSSAENQEGDPGTEKSTPPKMADAEPKRGVGSPAG
RKRSTGSASRSRKGDSAAQFLVFCQKHRDEVVAEHPDASEEEIEELLGSQWSMLNEKQKA
RYNTKFSLMISAQSEEDSGNTSGKKRTHTKRTDDPPEDVDVEDAPRKRLRTDKHSLRKQR
ETITDKTARTSSYKAIEAASSLKSQAATKNLSDACKPLKKRNRASATASSALGFNKSSSP
SASLTENEVSDNPGDEPSESPYESADETQTEASVSSKKSERGMAAKKEYVCQLCEKTGSL
LLCEGPCCGAFHLACLGLSQRPEGRFTCTECASGIHSCFVCKESKMEVKRCMVNQCGKFY
HEACVKKYPLTVFESRGFRCPLHSCMSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACL
AAGCSVIASNSIICTGHFTARKGKRHHTHVNVSWCFVCSKGGSLLCCEACPAAFHPDCLS
IEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFP
VFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFNEIKLQREAR
ETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKPTDENPCGSDSECLNRMLMF
ECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDE
EECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDT
RVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTSLSSEEKSK
KAKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWE
CPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFRSTQDGQSYCCEHDLRADSANNTKTE
KPFLDSLKAKGKRKKRRCWRRVTDGK

BLAST