GenomeNet

>rop:ROP_51690 no KO assigned | (GenBank) hypothetical protein (A)
MASPAEELDVDGVAVRLSSPDKIYYPKLGADGGTKRHLVEYYRTVALNGALLGALFDRPT
HLQRFPDGVEGEEIYQKRVPAKRPDHVDSCEVTFPSGRKADVLRVRSAANIVWAANLGNI
TFHPWAVRCPDVDHPDELRIDLDPQPGTGFDDARAVALDVLRPLLDELGLIGYPKTSGGR
GLHVYLRIEPRWDFIEVRRAGIALAREIERRSGDRATTSWWKEERGERIFLDFNQNARDK
TIASAYSARKTPIATVSTPVTWDELVDVHPDDFTIATVPALLEKRGDPMATMGDVAQSLD
VLLEMAERDTANGLGDLPYPPNYPKMPGEPKRVQPSRDRDRK

BLAST