GenomeNet

>rpa:RPA0262 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) rlp2; ribulose bisphosphate carboxylase-like protein; rubisco-like protein (A)
MTPDDIAGFYAKRADLDLDNYIELDFDFECAGDPHEAAAHLCSEQSTAQWRRVGFDEDFR
PRFAAKVLELSAEPRPSGFSVPVECAARGPVHACRVTIAHPHGNFGAKIPNLLSAVCGEG
VFFSPGIPLIRLQDIRFPEPYLAAFDGPRFGIAGVRERLQAFDRPIFFGVIKPNIGLPPQ
PFAELGYQSWTGGLDIAKDDEMLADVDWCPLAERAALLGDACRRASAETGVPKIYLANIT
DEVDRLTELHDVAVANGAGALLINAMPVGLSAVRMLRKHATVPLIAHFPFIAAFSRLANY
GIHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHEVLDCIRACLEPMGPIKPCLPVPGGSD
SAATLENVYRKVGSADFGFVPGRGVFGHPMGPAAGATSIRQAWDAIAAGIPVPDHAASHP
ELAAALRAFGGR

BLAST