GenomeNet

>rpa:RPA2169 rlp1; ribulose bisphosphate carboxylase-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MDMSERIIVTYQVAAAPAEIAARAEALAIEQSVECPLAAVTEQQIRDEIVGRVEAIAPIG
ETRFSVRVSLASATAPAEPGQLLNMLFGNSSIQPDVTLADVELPPAYPAAFGGPKLGISG
LRAKLGAPRRALTGSALKPQGLAPEALAGLAHRLALGGVDLIKDDHGIADQAFSPFAARV
PAVARAMREACAVRGAAMLYAPHVSGSLDDMRRQLDIVRREGLSVVMLMPMIVGLANFHL
IAKEAEGLIVLAHPSLAGAQRIAPDLLLGKLFRLLGADATIFPHYGGRFAYTPETCRALA
DAARRDWHDLKPCLPVPAGGIAIDRIKELLAFYGTDVMLLIGGSLLAAGEQLTEHAARFT
AEVASHGQ

BLAST