GenomeNet

>rpa:RPA3650 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP-dependent DNA ligase (A)
MASNKLSIYRKKRDFEQTAEPRGDAKVAPSKQRRFVIQKHDATRLHYDLRLEYGGVFKSW
AVTKGPSLDPNDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVQLWDRGYWECDDPERGF
KTGDLKFTLHGEKLHGSWVLVRMRHDRSGGKRTNWLLIKHRDDDAREGDANTVLDEDRSV
ASGRAMDTIAEGKGKAPKPFMLRKAATRVTADAVWDSNTGLAADKRAETGAAKKVAKSKP
TTSAKAKAAKSAKPASRSKPAAQGKRAAMPDFVPPQLCTSVERPPGGEGWGHEIKFDGYR
MQLRVEHGEARLLTRKGLDWTAKFGAIADEAASLPDAIIDTEVVALDSHGQPDFASLQAA
LSDGHTENLICFAFDLLYVDGEDLRGLPLAERKARLAALLKAARGRRKEGLIRYVEHFDT
GGDAILQSACKLSLEGIVSKKLDAAYRSGRSDGWTKAKCRAGHEVVIGGWKTTNGKFRSL
LVGVHRGDDLAYVGIVGTGFGQDVVKRILPELKAHKADTSPFSGANAPKKTREVHWVTPD
LVAEIEFAGFTGAGMVRQASFKGLRADKPAEEVEAEEPQRVELAEPAPMRRIAKASKSGK
PAAKRAAPRRADAARSEVMGVAISKPDKELWPASEIGAAITKRDLADYFAEVGDWLIPHI
KGRPCSILRAPDGIDGEHFFQRHAMPGMSNLIGLAKVSGDRKPYVQIDRVEGLIAAAQIG
GVELHPWNCAPNRYDVPGRLVFDLDPAPEVGFDEVITAAKEMKQRLEALGLKTFCKTTGG
KGLHVVVPLKPDDGIDWKAAKTFAQTVCAQMAEDSPEQYLLNMSKRKRIGKIFLDYLRND
RMSTAVAVLSPRARTGATVSMPLTWSQVKAGLDPKRYTIESVPALIKRSKAWTDYDDAAT
PLKAAIRTLTSGKT

BLAST