GenomeNet

>rpb:RPB_0300 rubisco-like protein Rlp2; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MTPDDIAGFYATRAELNPDDYIELDFDFECAGDPREAAAHLCSEQSTAQWRRVGIDEDFR
PRFAAKVLELHAEARQGFSTAVECAVRGPVHACRVTIAHPHRNFGPKIPNLLSAVCGEGV
FFSPGIPLIRLQDIRFPDSYLAAFEGPRFGIAGLRERLQAFDRPIFFGVIKPNIGLPAAP
FAELGYQSWRGGLDIAKDDEMLADVDWCPLAERAALLGDACRKAAAETGVPKIYLANITD
EVDRLIELHDVAVANGAGALLINAMPVGLSAVRMLRRHATVPLIAHFPFIAAFSRLATYG
IHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHEVLECVRACLEPMGPIKPCLPVPGGSDS
AATLERVYRKVGSVDFGFVPGRGVFGHPMGPAAGAASLRQAWDAIAAGIPVGEHAASHPE
LAAALQAFGDR

BLAST