GenomeNet

>rpb:RPB_1876 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP dependent DNA ligase, central (A)
MAASKTLTLYRNKRDFEQTAEPRGDAEVVPSKRRRFVIQKHDATRLHYDLRLEYDGVFKS
WAVTRGPSLDPRDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVQLWDRGYWDCDDPERG
FKTGDLKFTLDGEKVHGSWVLVRMRHDRNGGKRTNWLLIKHRDDDAREGKANDILDEDRS
VASGRTMKQIAEGKGRAPKPFMTGKVARVKADAVWDSNKGLAADARAADDAGKAARPKRA
AAKKAPKKAAAKSRTTKTTSRATRKPVKVAAMPDFIPPQLCTSVERPPGSDGWRHEIKFD
GYRMQLRIAHGEAALRTRKGLDWTAKFRAIADEAAGLPDAIIDTEIVALDHHGHPDFAAL
QAALSDGDSDKLICFAFDLLYADGEDLRSLPLSERKQRLQDLLKAARGRRKEGLIRYVEH
FETGGDAILQSACKLSLEGIVSKKLDAPYRSGRSDNWTKAKCRAGHEVVIGGWKTTAGKF
RSLMVGVQSDDRAGNHHLAYVGLVGTGFGQDVVKRILPELKARASKDNPFAGENAPRKTS
DVNWVTPDLVAEIEFAGFTGAGMVRQAAFKGLRADKPADEVVAEKPAQVGIARPKPKRGT
KAAPAVRKVASAASRAEVMGISISKPDKVLWPASEISEAITKLDLAHYYEAVGDWLIAHI
KGRPCSIVRAPDGIDGEHFFQRHAMPGMSNLIDLAKVSGDRKPYVQIDRVEGLIAVAQIG
GLELHPWNCAPGAYDVPGRLVFDLDPAPDVGFDDVVAAAREMKDRLETIGLSTFCKTTGG
KGLHVVVPLQPKDDVDWKQAKIFAQTVCAQMADDSPERYLLNMSKQQRKGKIFLDYLRND
RMSTAVAALSPRAREGATVSMPVTWSQVKAGLDPKRFTLGTVPALLRKTKAWADYDESAA
PLRAALEALASSGA

BLAST