GenomeNet

>rpb:RPB_3227 rubisco-like protein Rlp1; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MTDDRIIATYRVTSEPSRIADRAQGLAIEQSVECPLDAIGDPWVRDAIVGRVALIDQIGA
GRYAVRVALAAATAPAEPGQLLNMLFGNASIQPDVALVDVELPPAYLAAFGGPKLGLDGI
RARTGVHRRALTASALKPQGLAPAALAAIARQLAEGGVDLIKDDHGLADQAYSPFAARIA
AVGRAVDAANQASGRRALYAPHVSGSLDEMRRQLDLIRAETIPALMMMPMIVGLSNFHVI
AREAEGLVVLAHPALSGATRIAPPLLLGKLFRLLGADATVFPHAGGRFAYTPETCRALAD
AARGDWGGLKPCLPVPAGGIAIDRVEELLSFYGRDVMLLIGGSLLAARENLGAEAARFVA
EVAAHGA

BLAST