GenomeNet

>rpb:RPB_3963 ribulose-bisphosphate carboxylase form I small subunit CbbS (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRMTQGCFSYLPDLTDEQISAQVQYALGKGWAVNLEFTDDPHPRNTYWDMWGLPMFDLQD
AAGVMLELAECRKVYGDRYIRMSAFDSSHGWESVRLSFIVNRPKDEPGFRLDRQEVDGRN
MRYTTRSYAADKPEGSRYGG

BLAST