GenomeNet

>rpc:RPC_2184 ribulose 1 5-bisphosphate carboxylase large subunit-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MTEPRIVATYHIASDAERIEQRALALAIEQSVECPLEAIGDPAIVANIVGRVEDVAELQP
GRYAVRIGLAAATAPAEPGQLLNMLFGNSSIQPDIALADVELPAHYLTAFGGPRVGLAGI
RTLTGAQSRALTASALKPQGLSPAALASIAHQLALGGVDLIKDDHGLADQAFSPFAERAA
AVGKAVREANAARGGRTLYAPNISGTLDDMRRQLGVIRDEGIGAVLVAPMIVGVSNFHAI
VKEAAGLVVVAHPAMAGAAKIAAPLLLGRLFRLFGADATVFPNYGGRFAYSTASCLALAQ
AARDPFGKLNACIPTPAGGIMLQRVNELLRFYGQDVMLLIGGSLLASRERLTEQASRFVN
KVADYGQR

BLAST