GenomeNet

>rpe:RPE_0422 RuBisCO-like protein Rlp2; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MTPDDIAGFYANRADLNMADYIELDFEFECAGDPREAAAHLCSEQSTAQWHRVGIDEDFR
PRFAARVLDLHAEPQPSGFSIDVTCAATGPVHAVRVTIAHPHGNFGPKLPNLLSAVCGEG
VYFAPGIPLIRLQDIRFPDNYLEAFQGPQFGIAGLRQLLQAFDRPIFFGVIKPNIGLSAE
PFAELGYQSWIGGLDIAKDDEMLADVEWCPLAERAAALGAARRRAEQETGVPKMYLANIT
DEVDQLIPLHDLAVKNGANALLVNAMPVGLSGVRMLRKHAKVPLIAHFPFIAAFSRLARY
GIHSRVLTRLQRLAGFDVVIMPGFGPRMMTPEHEVLECVRACLEPMGPIKPCLPVPGGSD
NALTLEGLYRKVGTTDFGFVPGRGVFGHPMGPAGGAASIRQAWNAIASGIPVADYATNNP
ELAAAFAAFGKR

BLAST