GenomeNet

>rpe:RPE_1362 ribulose-bisphosphate carboxylase form I small subunit (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRVTQGCFSFLPDLTDDQIAAQVQYALGKGWAVNIEFTDDPHPRNTFWEMWGLPMFDLQD
AAGVLMELNECRKIYGDRYIRLSAFDSSHGWESVRLSFIVNRPKEEPGFRLERQEVDSRA
MRYTTKPYSSDRPEGRRYGGS

BLAST