GenomeNet

>rpe:RPE_3678 RuBisCO-like protein Rlp1; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSSPRIIATYHLASDADLVAERAKGLAIEQSVECPLAAVGDPVILDTIVGRVEDIAELTP
GRYAVRIGLAAATAPAEPGQLINMLFGNSSMQQDVTLVDVELPPSYLAAFGGPRLGLAGL
RALTGTQDRALTASALKPQGLSPAALARIAGQLARGGVDVIKDDHGIADQAYSPFAARVE
AVGRAVQEANVARDGHSLYAPNLSGTLDDMRRQLDLAREQGIAAVMVAPMIVGLANFHAV
VKAAAGMVVIAHPALSGVTRIAPPLLLGKLFRLFGADATIFPNAGGRFGFSTETCLQLAR
AGRDPWGALEPCMPVPAGGLTADRVAELLQFYGHDVMLLIGGGLLSARERLTEEAARFVN
EVAAHGKA

BLAST