GenomeNet

>rpf:Rpic12D_0086 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (GenBank) Glutathione S-transferase domain protein (A)
MEVLKWLFWQVGGLGPMAGQIGHFNVYAPERVPYAIERYTKETNRLYGVLDRRLADRPYI
AGNDYTIADIAAYPWIVPHAGHGQDLNDFPNLQRWFEGVGARPATQRAYAGVERAYSRRR
EDISDDERNVLLGQTASSTAR

BLAST