GenomeNet

>rpm:RSPPHO_00537 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) ccbS2; Ribulose bisphosphate carboxylase, small subunit (A)
MTLQDYASSLSDPNSRKLGTFSYLPPMDAAQLRKQIDYIVAKGWNPAIEHTEPHHARSHY
WYMWKLPLFGETNVDRILSEIDACKTAHPGHHVRLIGYDTIKQSQGTALIVHRAACPS

BLAST