GenomeNet

>rpm:RSPPHO_02788 Ribulose 1,5-bisphosphate carboxylase large subunit (EC:4.1.1.39); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MGLGMTSRITAIYHVTATAATIESRAQGIAVEQSVEMPLAAIDDPRVLEEIVGQVQSITD
LGQGVYEVRIGLAVETTGLEAGQLINMLYGNTSIQDDTVLWDAEFPEEVFAAFKGPNVGL
EGLRADKAPGRAMTCGALKPQGLPVARLADLARRFADAGPDFIKDDHGHADQAFSPYAER
VPAIARAVRESNARTGFKTRYLPSLNGNLDQMRAQIRLGQAEGLDTFMIAPMIAGFSTFH
TLVRENPTTAFFSHPTMTGASRIAPAFLHGKLFRLLGADAVIYTNHGGRFGFTRETCRAI
ARNATKPWGGLKGAVPVPAGGMTQDRVPEMVECYGADVILLIGGGLLLARERLTEETRAF
VEAVAALPAPPGPGAEEVA

BLAST