GenomeNet

>rpn:H374_4970 Penicillin-binding protein; K03587 cell division protein FtsI (penicillin-binding protein 3) (A)
MNLPSASLFANPQIVLDPETSVNKLAEILPDINKAKLIKELKSNKSFIWVKRDLLPSQQE
KIMSLGLLGFEFEEEQKRIYIFSNLLSHIIGYVGRDSVGLSGLELAYDKYLTNTDYELND
PKDQKAPLQLSIDIRLQSILNEEIDKTLKKFKAIGAVGIIADPNNGEILALVNKPDFDPH
YPSLAKPEELFNTASLGIYEMGSVFKALTMAVGFDTGVIKMNDAYDISYMKVGGFQLKDY
TPRQGWHSVPEIFLYSSNIGTSQIMLEIGKNDFKQYLKKLGLLDQLQIELPERGTPLFPS
EKRWNELTSVTMSYGYGISISPLHFVKAILPVVNGGTLYDLTLLKRKTKKVIGTKVFSEN
TSTQMNKLFRSVVKEGNGKRAEIKGYLIGGKTGTAEKLSQGIGGKKKYLKNSRASSFLGI
LPSSKPQYVLFIRFDEPKPIKESFGFATASWTAVPTAGRVFERMISLYGLEPIEQNEEES

BLAST