GenomeNet

>rpt:Rpal_0263 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) RiBisCO-like protein (A)
MTPDDIAGFYAKRADLDLDNYIELDFDFECAGDPREAAAHLCSEQSTAQWRRVGFDEDFR
PRFAAKVLELSAEPRPSGFSVPVECAARGEVHACRVTIAHPHGNFGAKIPNLLSAVCGEG
VFFSPGIPLIRLQDIRFPEPYLAAFDGPRFGIAGVRERLQAFDRPIFFGVIKPNIGLPPQ
PFAELGYQSWTGGLDIAKDDEMLADVDWCPLAERAALLGDACRRASAETGVPKIYLANIT
DEVDRLTELHDVAVVNGAGALLINAMPVGLSAVRMLRKHATVPLIAHFPFIAAFSRLANY
GIHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHEVLDCIRACLEPMGSIKPCLPVPGGSD
SAATLENVYRKVGSADFGFVPGRGVFGHPMGPAAGATSIRQAWDAIAAGIPVADHAASHP
ELAAALKAFGGR

BLAST