GenomeNet

>rpx:Rpdx1_0372 RuBisCO-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MTPDDIAGFYARRSELNLDDYIELDFDFECAGDPREAAAHLCSEQSTAQWRRVGFDEDFR
PRFAAKVLELSAEPRPSGFSTSVECAARGEVHACRVTIAHPHGNFGAKIPTLLSAVCGEG
VFFSPGIPLIRLQDIRFPDAYLAAFDGPRFGIAGLRERLQAFDRPIFFGVIKPNIGLPPQ
PFAELGYQSWSGGLDIAKDDEMLADVEWCPLAERAALLGDACRRASAETGVPKIYLANIT
DEVDRLTELHDVAVANGAGALLVNAMPVGLSAVRMLRKHATVPLMAHFPFIAAFSRLANY
GIHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHEVLDCIRACLEPMGPIKPCLPVPGGSD
SAATLENVYRKVGSADFGFVPGRGVFGHPMGPAAGAASIRQAWDAIAAGIPVADHAAGHP
ELAAALQAFGGR

BLAST