GenomeNet

>rrs:RoseRS_3804 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (EC:2.7.1.21) (A)
MTRLLGGRIEVICGCMFSGKTEELIRRLNHVRLARQRLIAFTPRRDTRYRLGSLVSHNGL
SVEARVIDSIRDIPAYLDSDVDVVAVDELHLLDDPPDAAREVCQQLADRGLRVIVAGLDQ
DFRAQPFPAMAQLMAVAEQVDKLYAICVRCGAYATRSQRLIDGKPAPADAPTIVVGGQEL
YEARCRACYEPAQ

BLAST