GenomeNet

>rru:Rru_A0364 ubiquinol-cytochrome c reductase, iron-sulfur subunit (EC:1.10.2.2); K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] (A)
MAEAEHTASTPGGESSRRDFLIYGTTAVGAVGVALAVWPFIDFMNPAADTLALASTEVDV
SAIAEGQAITVTWRGKPVFVRHRTQKEIDEARAVDPATLRDPQTDEARVQQAQWLVMVGV
CTHLGCIPLGQKAGDPKGDFDGWFCPCHGSHYDSAGRIRKGPAPLNLPVPPYAFTDDTTV
LIG

BLAST