GenomeNet

>rsc:RCFBP_10428 tufB; protein chain elongation factor ef-tu; K02358 elongation factor Tu (A)
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDSYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVIK
VGEEIEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPEGKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE

BLAST