GenomeNet

>rsc:RCFBP_21348 alkaline phosphatase signal peptide protein (EC:3.1.3.1); K01077 alkaline phosphatase [EC:3.1.3.1] (A)
MTKQSNRLLRAGTLALAATAAAAALAVLPAHAAGEARNVIFFLGDGMGPTTVTAARIYKA
GEAGQLTMESLKRTARIKTYSNDAQTTDSAPSMSAYMTGVKMNNEVISMSADTQASDSAG
KGYVSGADTTCPTGNGTPATTLLELAKAAGKSVGAVTTTRVTHATPAATYAHLCHRDGEN
QIAAQGTPGNALYNAALKDGLDVLLGGGRRHFVPQGTTGSKRTDSTDLIAQFQAANYTYV
STGTQLAAVDPAATTKLLGLFSLDHMSYELDRVKTSVDEPSLADMTEKAIRVLQKNGNGY
FLMVEGGRIDHALHGTNAKRALEDTVAFDEAIKRALSLVDRSNTLIVVTADHDHTMTING
YAHRGNPILGLSTDLKTRQPQLAADGLPYTTLVFGNGAGTRKATRDNLAAVDTAADDYQQ
EAGVRFGTSGSETHGGGDVMLFSSGPGSAPLKGTLDNTKVFGAVRSAMGL

BLAST